Buy Vasoactive Intestinal Peptide (VIP) – 6mg

$70.00

+ Free Shipping

VIP 6mg – A powerful research peptide with potent anti-inflammatory and antifibrotic properties, extensively studied for its role in neurodegenerative diseases, pulmonary fibrosis, inflammatory bowel disease, and cardiac fibrosis.

Category:

Buy Vasoactive Intestinal Peptide (VIP) for Neuroprotective and Cardiovascular Research with Discreet Worldwide Shipping

Vasoactive Intestinal Peptide (VIP) 6 mg is a high-purity research peptide known for its broad biological significance across neuroprotective, gastrointestinal, and immune-modulating research applications. At Peptide Online Store, we supply only research-grade VIP peptides manufactured to ≥99% purity, ensuring reliability, consistency, and performance in scientific investigations.


What is Vasoactive Intestinal Peptide (VIP)?

Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It was first isolated from porcine intestine and has since been identified as a multifunctional signaling molecule involved in smooth muscle relaxationvasodilationneurotransmission, and immunoregulation.

In research, VIP is studied for its potential roles in circadian rhythm regulationgastrointestinal motilityanti-inflammatory signaling, and neuroprotection.


How Does Vasoactive Intestinal Peptide (VIP) Work in the Body?

VIP binds primarily to VPAC1 and VPAC2 receptors, which are G-protein-coupled receptors distributed in the central nervous system, lungs, liver, and immune tissues.

Upon binding, VIP activates adenylate cyclase, increasing cyclic AMP (cAMP) production, leading to:

  • Relaxation of smooth muscles in blood vessels and airways

  • Modulation of immune cell activity

  • Neuroprotective effects via reduced inflammation and oxidative stress

  • Regulation of circadian rhythm through the suprachiasmatic nucleus

These mechanisms make VIP a valuable subject in neurological, cardiovascular, and immunological research.


Key Benefits of Vasoactive Intestinal Peptide (VIP)

  • Promotes vasodilation and improved microcirculation in experimental models

  • Supports neuroprotective pathways and neuron survival

  • Demonstrates anti-inflammatory properties in immune cell research

  • Aids in respiratory and gastrointestinal studies involving smooth-muscle regulation

  • Explored for circadian rhythm and sleep regulation mechanisms

(For laboratory and in-vitro research purposes only.)


Product Details and Purity

  • Product Name: Vasoactive Intestinal Peptide (VIP)

  • Molecular Formula: C147H237N43O42S

  • Molecular Weight: ~3325 Da

  • Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂

  • Purity: ≥99% (HPLC and Mass Spectrometry verified)

  • Form: Lyophilized powder

  • Quantity: 6 mg per vial

  • Storage: Store at −20 °C, protected from light and moisture

  • Solubility: Soluble in sterile water or buffer


Dosage & Usage Guidelines

  • Reconstitute with bacteriostatic water or sterile saline before use.

  • Typical research concentrations range from 10 µg/mL to 100 µg/mL, depending on the experimental design.

  • Avoid repeated freeze-thaw cycles.

  • Label clearly as “For Research Use Only — Not for Human Consumption.”


Safety, Side Effects & Precautions

  • Handle using protective gloves, mask, and lab coat.

  • Avoid direct contact or inhalation.

  • Dispose of unused peptide following institutional biosafety protocols.

  • No human or veterinary applications are approved — research use only.


Quality Assurance & Testing

Every batch of VIP peptide undergoes rigorous HPLC and Mass Spectrometry testing to confirm purity and identity.
Manufactured in ISO-certified, GMP-compliant facilities, our peptides meet the highest international standards for research-grade materials.

Each vial includes a Certificate of Analysis (COA) verifying peptide composition and batch traceability.


Commitment to Quality and Compliance

Peptide Online Store ensures:

  • GMP manufacturing standards

  • Ethical and traceable sourcing

  • Strict batch-to-batch consistency

  • Compliance with international peptide research regulations

Our commitment guarantees safe, consistent, and reliable peptides for scientific exploration.


Potential Applications (For Research Use Only)

  • Neuroprotection and CNS signaling studies

  • Cardiovascular physiology and vascular tone regulation

  • Pulmonary function and asthma models

  • Gastrointestinal motility and secretion research

  • Circadian rhythm and endocrine system research

(Not intended for human or animal therapeutic use.)


Why Choose Peptide Online Store for Vasoactive Intestinal Peptide (VIP)?

  • ≥99% HPLC-verified purity

  • Discreet global shipping in temperature-controlled packaging

  • Competitive pricing for bulk and single-vial orders

  • Secure online ordering and multiple payment options

  • Exceptional customer support with scientific knowledge

Peptide Online Store is trusted by researchers worldwide for its purity, transparency, and reliability.


Shipping & Delivery Information

  • Worldwide delivery via trusted carriers

  • Orders processed within 24–48 hours

  • Discreet and temperature-controlled packaging

  • Real-time tracking updates for all shipments

  • Express delivery options available


How to Order Online

  1. Navigate to PeptideOnlineStore.eu

  2. Search for “Vasoactive Intestinal Peptide (VIP).”

  3. Select quantity and add to cart.

  4. Proceed to secure checkout.

  5. Receive email confirmation and shipment tracking.

All transactions are SSL-encrypted for data protection and payment security.


Frequently Asked Questions (FAQ)

Q1: What is the purity of your VIP peptide?
A: Each batch is HPLC-verified to ensure ≥99% purity.

Q2: Can VIP be used for clinical trials?
A: VIP is for research use only, not approved for human or clinical use.

Q3: How should VIP be stored?
A: Store at −20 °C in a dry, dark environment; reconstituted solutions should be refrigerated.

Q4: Do you provide a Certificate of Analysis (COA)?
A: Yes, every order includes a COA for verification.

Q5: How long does shipping take?
A: International orders typically arrive within 5–10 business days, depending on destination.


Related Products to Vasoactive Intestinal Peptide (VIP)

  • Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP)

  • Growth Hormone-Releasing Peptide-6 (GHRP-6)

  • BPC-157

  • Thymosin Beta-4 (TB-500)

Explore these complementary peptides for advanced physiological and neurological studies.


Final Thoughts

Vasoactive Intestinal Peptide (VIP) remains an essential research peptide for exploring neuroprotective, cardiovascular, and immunomodulatory pathways. At Peptide Online Store, our VIP 6 mg vials deliver exceptional purity, consistency, and reliability, ensuring optimal results for your laboratory investigations.

Order today to experience fast, discreet, and globally trusted peptide delivery.

Reviews

There are no reviews yet.

Be the first to review “Buy Vasoactive Intestinal Peptide (VIP) – 6mg”

Your email address will not be published. Required fields are marked *

Shopping Cart